[maker-devel] Error from Pseudo gene identification scripts
Quanwei Zhang
qwzhang0601 at gmail.com
Mon Dec 11 07:55:42 MST 2017
Hello Shinhan and Michael:
Thanks for your help. The sequence is shown below, which is reported
protein sequence by Maker2. The error occur when I run "pseudo_wrap.py".
With the blast results and predicted protein sequences by Maker2, I am
trying to predict the pseudo genes in the whole assembly (both for those in
the intergenic regions and those among the predicted proteins).
>maker-Contig2656-snap-gene-1.9-mRNA-1 protein AED:0.04 eAED:0.04
QI:43|1|1|1|0.85|0.87|8|1768|297
MGTSLDIKIKRANKVYHAGEMLSGVVVISSKDSVQHQGMSLTMEGTVNLQLSAKSVGVFE
AFYNSVKPIQIINSTIEMVKPGKFPSGKTEIPFEFPLHVKGNKVLYETYHGVFVNIQYVL
RCDMRRSLLAKDLTKTCEFIVHSVPQKGKLTPSPVDFTITPETLQNVKERALLPKFLIRG
HLNSTNCAITQPLTGELVVEHSDAAIRSIELQLVRVETCGCAEGYARDATEIQNIQIADG
DVCRSLSVPIYMVFPRLFTCPTLETTNFKVEFEINVVVLLHADHLITENFPLKLCRT
#below is the blast results
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2656 100.000 51
0 0 220 270 424151 424303 3.23e-25 111
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2656 93.103 58 4
0 170 227 423367 423540 4.19e-24 108
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2656 85.000 60 7
1 66 123 404001 404180 5.67e-24 107
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2656 100.000 48
0 0 20 67 402613 402756 3.47e-20 96.7
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2656 50.725 69
25 1 238 297 426022 426228 6.48e-09 63.2
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2656 67.308 52
15 2 118 168 417125 417277 2.07e-08 61.6
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2656 100.000 25
0 0 145 169 419825 419899 5.54e-06 53.9
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2656 76.667 30 5
1 1 30 382922 383005 0.012 43.5
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig3808 22.545 275
175 9 15 283 112218 111490 1.13e-07 59.3
maker-Contig2656-snap-gene-1.9-mRNA-1 Contig2791 26.667 60
43 1 236 295 20108374 20108550 9.6 34.3
Many thanks
Best
Quanwei
2017-12-11 8:13 GMT-05:00 Shin-Han Shiu <shius at msu.edu>:
> Hi Mike and Carson, we will take over from here. Thanks for referring the
> message to us.
>
> Quanwei, it looks like for some reason your input sequence file is missing
> "maker-Contig2656-snap-gene-1.9-mRNA-1". This can be an issue with the
> sequence name since the code use space as delimiter in places. Can you
> check your sequence file for this sequence and let us know how the name
> after ">" look like?
>
> Nick, sorry for bugging you. Do you have any input on this?
>
> Shinhan
>
> On 12/10/2017 8:37 PM, Michael Campbell wrote:
>
> Hi Quanwei,
>
> My guess would be a file format issue, but the code has evolved since I
> worked with it. The last time that ran it the fasta header had to contain
> only the sequence ID without a space after it. That was the big gotcha that
> I remember.
>
> I’ve ccd Shin-Han Shiu on this one. The pipeline was developed in his lab.
>
> Thanks,
> Mike
>
> On Dec 8, 2017, at 8:46 AM, Quanwei Zhang <qwzhang0601 at gmail.com> wrote:
>
> Thank you Carson and Michael.
>
> Best
> Quanwei
>
> 2017-12-07 23:42 GMT-05:00 Carson Holt <carsonhh at gmail.com>:
>
>> I’m going to CC Michael Campbell on this. I wasn’t really involved with
>> any of the pseudogene accessory scripts and protocols that went with the
>> MAKER-P publication nor have I really been involved with pseudogene
>> annotation in general. So Michael might have more insight here.
>>
>> —Carson
>>
>> On Dec 7, 2017, at 2:44 PM, Quanwei Zhang <qwzhang0601 at gmail.com> wrote:
>>
>> Hello:
>>
>> I am trying to identify pseudo genes following
>> http://shiulab.plantbiology.msu.edu/index.php/Protocol:Pseudogene
>>
>> After I get the blast result, I am trying to scan pseudogenes by the
>> command "python pseudo_wrap.py parameter". But I got the following errors.
>> Do you have any ideas and suggestions about the errors? Thanks.
>>
>> ##below shows reported errors
>> Traceback (most recent call last):
>> File "/gs/gsfs0/users/qzhang/tools/maker2_pseudogene/pseudo_pkg//ParseBlast.py",
>> line 4330, in <module>
>> parse.get_qualified4(blast,fasta,E,I,L,P,Q)
>> File "/gs/gsfs0/users/qzhang/tools/maker2_pseudogene/pseudo_pkg//ParseBlast.py",
>> line 3050, in get_qualified4
>> N = sizes[L[0]]
>> KeyError: 'maker-Contig2656-snap-gene-1.9-mRNA-1'
>> Traceback (most recent call last):
>> File "/gs/gsfs0/users/qzhang/tools/maker2_pseudogene/pseudo_pkg/script_step3b.py",
>> line 98, in <module>
>> oup.write("%s\t%s\t%s\t%s\n" % (all_contigs[i][0][0],
>> IndexError: list index out of range
>> Done!
>>
>> Best
>> Quanwei
>> _______________________________________________
>> maker-devel mailing list
>> maker-devel at box290.bluehost.com
>> http://box290.bluehost.com/mailman/listinfo/maker-devel_yandell-lab.org
>> <https://urldefense.proofpoint.com/v2/url?u=http-3A__box290.bluehost.com_mailman_listinfo_maker-2Ddevel-5Fyandell-2Dlab.org&d=DwMFaQ&c=nE__W8dFE-shTxStwXtp0A&r=rf2UnAHeUSb4ulp2JbXt_w&m=4eCUx-nUmZ43poIB8geM9XkIKXoND4Yzi4aw4bXAfUU&s=2GYyuVGmT8vENvvk0LPCHjSUEmEzXdcyOnhXDjoTEcQ&e=>
>>
>>
>>
>
> --
> --------------------------------------
> Shin-Han Shiu
> Michigan State University
> Department of Plant Biology
> 2265 Mol Plant Sci Bldg
> (TEL) +1-517-353-7196 <(517)%20353-7196>http://goo.gl/keiHZX <https://urldefense.proofpoint.com/v2/url?u=http-3A__goo.gl_keiHZX&d=DwMDaQ&c=nE__W8dFE-shTxStwXtp0A&r=amxxAQj1r58HtnljR_ldsiP-fOO39FxiO68ZT1UBHoE&m=2co1_3xFiHR-sHwprAR0Wh1nMeSutUJ7n-TAibVN28c&s=Mt70of3YH2ihTytQ-XPiKJS0rOpA_YAxJEuEyLFK1BQ&e=>
> --------------------------------------
>
>
-------------- next part --------------
An HTML attachment was scrubbed...
URL: <http://yandell-lab.org/pipermail/maker-devel_yandell-lab.org/attachments/20171211/42fb3a6a/attachment-0003.html>
More information about the maker-devel
mailing list